HPA007608

MGAT4A antibody from Sigma-Aldrich
GnT-4a, GnT-Iva
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007608
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007608, RRID:AB_10602008
Product name
Anti-MGAT4A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007608
Antibody type
Polyclonal
Antigen
mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFW
AITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGD
ILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRI
GKFENGVAEGMVDPSLNPISAFRLSVIQ
Storage
-20C
Provider Type Product Number
- No reagents -