Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010103-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010103-M05, RRID:AB_1137514
- Product name
- TSPAN1 monoclonal antibody (M05), clone 3B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TSPAN1.
- Antigen sequence
YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTM
KGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNV
TNTANETCTKQKAHDQKVEGCFNQLLYDIRTN- Isotype
- IgG
- Antibody clone number
- 3B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Tspan-1 interacts with the thiamine transporter-1 in human intestinal epithelial cells and modulates its stability.
Nabokina SM, Senthilkumar SR, Said HM
American journal of physiology. Gastrointestinal and liver physiology 2011 Nov;301(5):G808-13
American journal of physiology. Gastrointestinal and liver physiology 2011 Nov;301(5):G808-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TSPAN1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol