Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311091 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Enoyl CoA Hydratase Domain Containing 1 (ECHDC1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ECHDC1 antibody: synthetic peptide directed towards the middle region of human ECHDC1
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus
- Host
- Rabbit
- Antigen sequence
GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSG
SDLNA VKSLGTPEDG- Vial size
- 50 µg
Submitted references Genome-wide association study provides evidence for a breast cancer risk locus at 6q22.33.
Gold B, Kirchhoff T, Stefanov S, Lautenberger J, Viale A, Garber J, Friedman E, Narod S, Olshen AB, Gregersen P, Kosarin K, Olsh A, Bergeron J, Ellis NA, Klein RJ, Clark AG, Norton L, Dean M, Boyd J, Offit K
Proceedings of the National Academy of Sciences of the United States of America 2008 Mar 18;105(11):4340-5
Proceedings of the National Academy of Sciences of the United States of America 2008 Mar 18;105(11):4340-5
No comments: Submit comment
No validations: Submit validation data