Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010063-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010063-M01, RRID:AB_606087
- Product name
- COX17 monoclonal antibody (M01), clone 4G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant COX17.
- Antigen sequence
MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDA
CIIEKGEEHCGHLIEAHKECMRALGFKI- Isotype
- IgG
- Antibody clone number
- 4G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dysregulation of intracellular copper homeostasis is common to transgenic mice expressing human mutant superoxide dismutase-1s regardless of their copper-binding abilities.
Tokuda E, Okawa E, Watanabe S, Ono S, Marklund SL
Neurobiology of disease 2013 Jun;54:308-19
Neurobiology of disease 2013 Jun;54:308-19
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- COX17 monoclonal antibody (M01), clone 4G2. Western Blot analysis of COX17 expression in IMR-32.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged COX17 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to COX17 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol