ABIN634328

antibody from antibodies-online

Targeting: PRDX5 ACR1, AOEB166, B166, MGC117264, MGC142283, MGC142285, PLP, PMP20, PRDX6, PRXV, SBBI10

Western blot

Antibody data

Submit

Validation data

Product number: ABIN634328 - Provider product page
Provider: antibodies-online
Product name: anti-Peroxiredoxin 5 (PRDX5) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: PRDX5 antibody was raised using the middle region of PRDX5 corresponding to a region with amino acids TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

PRDX5 protein structure - ABIN634328 shown in red.