H00025824-A01
antibody from Abnova Corporation
Targeting: PRDX5
ACR1, AOEB166, B166, MGC117264, MGC142283, MGC142285, PLP, PMP20, PRDX6, PRXV, SBBI10
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00025824-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00025824-A01, RRID:AB_463130
- Product name
- PRDX5 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PRDX5.
- Antigen sequence
LPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGR
AHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFG
NRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPN
IISQL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Glutathione-dependent and -independent oxidative stress-control mechanisms distinguish normal human mammary epithelial cell subsets.
TNF-related apoptosis-inducing ligand suppresses PRDX4 expression.
Kannan N, Nguyen LV, Makarem M, Dong Y, Shih K, Eirew P, Raouf A, Emerman JT, Eaves CJ
Proceedings of the National Academy of Sciences of the United States of America 2014 May 27;111(21):7789-94
Proceedings of the National Academy of Sciences of the United States of America 2014 May 27;111(21):7789-94
TNF-related apoptosis-inducing ligand suppresses PRDX4 expression.
Wang HQ, Du ZX, Liu BQ, Gao YY, Meng X, Guan Y, Zhang HY
FEBS letters 2009 May 6;583(9):1511-5
FEBS letters 2009 May 6;583(9):1511-5
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRDX5 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of PRDX5 expression in HL-60 ( Cat # L014V1 ).