HPA027958

NSUN4 antibody from Sigma-Aldrich
MGC22960, SHTAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027958
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027958, RRID:AB_10600085
Product name
Anti-NSUN4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027958
Antibody type
Polyclonal
Antigen
NOP2/Sun domain family, member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVNEAISHWELQSEGGQSAAPSPASWACSPNLRCF
TFDRGDISRFPPARPGSLGVMEYYLMDAASLLPVL
ALGL
Storage
-20C
Provider Type Product Number
- No reagents -