Explore
Validate
LearnH00026121-M02
antibody from Abnova Corporation
Targeting: PRPF31
hPrp31, NY-BR-99, PRP31, RP11, SNRNP61
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026121-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026121-M02, RRID:AB_10642596
- Product name
- PRPF31 monoclonal antibody (M02), clone 8E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PRPF31.
- Antigen sequence
GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVV
YGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAE
KKVAEANQKYFSSMAEFLKVKGEKSGLMST- Isotype
- IgG
- Antibody clone number
- 8E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references An integrative analysis of colon cancer identifies an essential function for PRPF6 in tumor growth.
Adler AS, McCleland ML, Yee S, Yaylaoglu M, Hussain S, Cosino E, Quinones G, Modrusan Z, Seshagiri S, Torres E, Chopra VS, Haley B, Zhang Z, Blackwood EM, Singh M, Junttila M, Stephan JP, Liu J, Pau G, Fearon ER, Jiang Z, Firestein R
Genes & development 2014 May 15;28(10):1068-84
Genes & development 2014 May 15;28(10):1068-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PRPF31 expression in transfected 293T cell line by PRPF31 monoclonal antibody (M02), clone 8E1.Lane 1: PRPF31 transfected lysate (Predicted MW: 60.01 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in PC-12.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PRPF31 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
