Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029801-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029801-M02, RRID:AB_875936
- Product name
- ZDHHC8 monoclonal antibody (M02), clone 1C5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ZDHHC8.
- Antigen sequence
MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPF
TDPAGSL- Isotype
- IgG
- Antibody clone number
- 1C5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ZDHHC8 expression in transfected 293T cell line by ZDHHC8 monoclonal antibody (M02), clone 1C5.Lane 1: ZDHHC8 transfected lysate (Predicted MW: 81.443 KDa).Lane 2: Non-transfected lysate.