HPA026811

DMBX1 antibody from Sigma-Aldrich
OTX3, PAXB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026811
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026811, RRID:AB_10603660
Product name
Anti-DMBX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026811
Antibody type
Polyclonal
Antigen
diencephalon/mesencephalon homeobox 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLTITPVAPGGGLLGPSHSYSSSPLSLFRLQEQFR
QHMAATNNLVHYSSFEVGGPAPAAAAAAAAVPYLG
VNMAPLGSLHCQSYYQSLSAAAAAHQGVWGSPLLP
APPAGLAPASATLNSKTTSIENLRLRAKQHAASLG
LDTLP
Storage
-20C
Provider Type Product Number
- No reagents -