Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007295-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007295-M01, RRID:AB_534780
- Product name
- TXN monoclonal antibody (M01), clone 2A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TXN.
- Antigen sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPC
KMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE
VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV- Isotype
- IgG
- Antibody clone number
- 2A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Response of esophageal cancer cells to epigenetic inhibitors is mediated via altered thioredoxin activity.
Ahrens TD, Timme S, Ostendorp J, Bogatyreva L, Hoeppner J, Hopt UT, Hauschke D, Werner M, Lassmann S
Laboratory investigation; a journal of technical methods and pathology 2016 Mar;96(3):307-16
Laboratory investigation; a journal of technical methods and pathology 2016 Mar;96(3):307-16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TXN monoclonal antibody (M01), clone 2A7 Western Blot analysis of TXN expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TXN expression in transfected 293T cell line by TXN monoclonal antibody (M01), clone 2A7.Lane 1: TXN transfected lysate(11.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TXN is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TXN on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of TXN transfected lysate using anti-TXN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TXN MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol