H00009669-M02

EIF5B antibody from Abnova Corporation
DKFZp434I036, FLJ10524, IF2, KIAA0741

Antibody data

Product number
H00009669-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009669-M02, RRID:AB_1574646
Product name
EIF5B monoclonal antibody (M02), clone 3F9
Provider product page
Abnova Corporation - H00009669-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EIF5B.
Antigen sequence
QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQ
EVCVKIEPIPGESPKMFGRHFEATDILVSKISRQS
IDALKDWFRDEMQKSDWQLIVELKKVFE
Isotype
IgG
Antibody clone number
3F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -