Antibody data

Product number
H00010721-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010721-M09, RRID:AB_1137381
Product name
POLQ monoclonal antibody (M09), clone 1C11
Provider product page
Abnova Corporation - H00010721-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant POLQ.
Antigen sequence
DGFVQTILGRRRYLPGIKDNNPYRKAHAERQAINT
IVQGSAADIVKIATVNIQKQLETFHSTFKSHGHRE
GMLQSDRTGLSRKRKLQGMFCPIRGGFFILQLHDE
LLYE
Isotype
IgG
Antibody clone number
1C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -