H00007001-M01
antibody from Abnova Corporation
Targeting: PRDX2
MGC4104, NKEFB, PRP, PRX2, PRXII, TDPX1, TSA
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007001-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007001-M01, RRID:AB_606835
- Product name
- PRDX2 monoclonal antibody (M01), clone 4E10-2D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PRDX2.
- Antigen sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKG
KYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC
EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLA
DVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQ
ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAG
WKPGSDTIKPNVDDSKEYFSKHN- Isotype
- IgG
- Antibody clone number
- 4E10-2D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.
Identification of a new panel of serum autoantibodies associated with the presence of in situ carcinoma of the breast in younger women.
Gemoll T, Roblick UJ, Szymczak S, Braunschweig T, Becker S, Igl BW, Bruch HP, Ziegler A, Hellman U, Difilippantonio MJ, Ried T, Jörnvall H, Auer G, Habermann JK
Cellular and molecular life sciences : CMLS 2011 Oct;68(19):3261-74
Cellular and molecular life sciences : CMLS 2011 Oct;68(19):3261-74
Identification of a new panel of serum autoantibodies associated with the presence of in situ carcinoma of the breast in younger women.
Desmetz C, Bascoul-Mollevi C, Rochaix P, Lamy PJ, Kramar A, Rouanet P, Maudelonde T, Mangé A, Solassol J
Clinical cancer research : an official journal of the American Association for Cancer Research 2009 Jul 15;15(14):4733-41
Clinical cancer research : an official journal of the American Association for Cancer Research 2009 Jul 15;15(14):4733-41
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRDX2 monoclonal antibody (M01), clone 4E10-2D2 Western Blot analysis of PRDX2 expression in Hela ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PRDX2 expression in transfected 293T cell line by PRDX2 monoclonal antibody (M01), clone 4E10-2D2.Lane 1: PRDX2 transfected lysate(21.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PRDX2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol