WH0007753M1

ZNF202 antibody from MilliporeSigma / Merck KGaA
ZKSCAN10, ZSCAN42
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0007753M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0007753M1, RRID:AB_1844287
Product name
Monoclonal Anti-ZNF202 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0007753M1
Antibody type
Monoclonal
Antigen
ZNF202 (NP_003446, a.a. 301-401) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
QEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSL
EDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRF
GTNISQVNSFVNLRETTPVHPLLGRHHDCS* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -