AV33549

ZNF202 antibody from MilliporeSigma / Merck KGaA
ZKSCAN10, ZSCAN42
No application information provided.

Antibody data

Product number
AV33549
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV33549, RRID:AB_1859119
Product name
Anti-ZNF202 (AB1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV33549
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF202 with an internal ID of P04604
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQ
RDDPVLETSHQNFRR
Storage
-20C
Provider Type Product Number
- No reagents -