Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182887 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-alpha-1-B Glycoprotein (A1BG) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-A1BG antibody: synthetic peptide directed towards the N terminal of human A1BG
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHE
FLEVP EAQEDVEATF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome.
LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy.
Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods.
Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders.
Cysteine-rich secretory protein 3 is a ligand of alpha1B-glycoprotein in human plasma.
Kim YS, Gu BH, Choi BC, Kim MS, Song S, Yun JH, Chung MK, Choi CH, Baek KH
International journal of molecular medicine 2013 Mar;31(3):707-16
International journal of molecular medicine 2013 Mar;31(3):707-16
LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy.
Surin B, Sachon E, Rougier JP, Steverlynck C, Garreau C, Lelongt B, Ronco P, Piedagnel R
Proteomics 2013 Jan;13(1):142-52
Proteomics 2013 Jan;13(1):142-52
Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods.
Abdul-Rahman PS, Lim BK, Hashim OH
Electrophoresis 2007 Jun;28(12):1989-96
Electrophoresis 2007 Jun;28(12):1989-96
Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders.
Abdi F, Quinn JF, Jankovic J, McIntosh M, Leverenz JB, Peskind E, Nixon R, Nutt J, Chung K, Zabetian C, Samii A, Lin M, Hattan S, Pan C, Wang Y, Jin J, Zhu D, Li GJ, Liu Y, Waichunas D, Montine TJ, Zhang J
Journal of Alzheimer's disease : JAD 2006 Aug;9(3):293-348
Journal of Alzheimer's disease : JAD 2006 Aug;9(3):293-348
Cysteine-rich secretory protein 3 is a ligand of alpha1B-glycoprotein in human plasma.
Udby L, Sørensen OE, Pass J, Johnsen AH, Behrendt N, Borregaard N, Kjeldsen L
Biochemistry 2004 Oct 12;43(40):12877-86
Biochemistry 2004 Oct 12;43(40):12877-86
No comments: Submit comment
No validations: Submit validation data