Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA048823 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA048823, RRID:AB_2680532
- Product name
- Anti-PLG
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP
VSTEQLAPTAPPELTPVVQDCY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Bioprosthetic Valve Deterioration
A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection
Sakaue T, Koyama T, Nakamura Y, Okamoto K, Kawashima T, Umeno T, Nakayama Y, Miyamoto S, Shikata F, Hamaguchi M, Aono J, Kurata M, Namiguchi K, Uchita S, Masumoto J, Yamaguchi O, Higashiyama S, Izutani H
JACC: Basic to Translational Science 2023;8(7):862-880
JACC: Basic to Translational Science 2023;8(7):862-880
A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection
Månberg A, Bradley F, Qundos U, Guthrie B, Birse K, Noël-Romas L, Lindskog C, Bosire R, Kiarie J, Farquhar C, Burgener A, Nilsson P, Broliden K
Molecular & Cellular Proteomics 2019;18(3):461-476
Molecular & Cellular Proteomics 2019;18(3):461-476
No comments: Submit comment
No validations: Submit validation data