HPA057366

LONRF2 antibody from Atlas Antibodies
FLJ45273, RNF192

Antibody data

Product number
HPA057366
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA057366, RRID:AB_2683420
Product name
Anti-LONRF2
Provider product page
Atlas Antibodies - HPA057366
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LAPDDNSLLLLRAELYLTMKNYEQALQDASAACQN
EPLLIKGHQVKAQALSGLGRSKEVLKEFLYC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.