Antibody data

Product number
H00005919-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005919-M02, RRID:AB_1204896
Product name
RARRES2 monoclonal antibody (M02), clone 3E3
Provider product page
Abnova Corporation - H00005919-M02
Antibody type
Monoclonal
Antigen
RARRES2 (NP_002880.1, 17 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reactivity
Human
Host
Mouse
Antigen sequence
VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETS
VESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPE
CKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIET
QVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAF
SKALPRS
Isotype
IgG
Vial size
100 µg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -