ABIN404770
antibody from antibodies-online
Targeting: REPIN1
AP4, H_DJ0584D14.12, RIP60, Zfp464, ZNF464
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404770 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Replication Initiator 1 (REPIN1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-REPIN1 antibody: synthetic peptide directed towards the middle region of human REPIN1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
GNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGP
RPRGR PAVTAPRPGG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells.
Kim MY, Jeong BC, Lee JH, Kee HJ, Kook H, Kim NS, Kim YH, Kim JK, Ahn KY, Kim KK
Proceedings of the National Academy of Sciences of the United States of America 2006 Aug 29;103(35):13074-9
Proceedings of the National Academy of Sciences of the United States of America 2006 Aug 29;103(35):13074-9
No comments: Submit comment
No validations: Submit validation data