HPA019674

NPAS2 antibody from Sigma-Aldrich
bHLHe9, MOP4, PASD4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019674
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019674, RRID:AB_10601275
Product name
Anti-NPAS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019674
Antibody type
Polyclonal
Antigen
neuronal PAS domain protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKPEFIVCTHSVVSYADVRVERRQELALEDPPSEA
LHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSP
SASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALP
RSATLPQELPVP
Storage
-20C
Provider Type Product Number
- No reagents -