H00026355-B01P

FAM162A antibody from Abnova Corporation
C3orf28, E2IG5
No application information provided.

Antibody data

Product number
H00026355-B01P
Provider
Abnova Corporation
Product name
FAM162A purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00026355-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FAM162A protein.
Antigen sequence
MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLK
RINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKI
LIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISY
LMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKK
ARLKEEAAMKAKTE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -