HPA035856

FAM162A antibody from Sigma-Aldrich
C3orf28, E2IG5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA035856, RRID:AB_10611965
Product name
Anti-FAM162A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA035856
Antibody type
Polyclonal
Antigen
family with sequence similarity 162, member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNR
VPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEML
DAAKNKMRV
Storage
-20C
Provider Type Product Number
- No reagents -