Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011138-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011138-M02, RRID:AB_607155
- Product name
- TBC1D8 monoclonal antibody (M02), clone 1A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TBC1D8.
- Antigen sequence
MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDL
EARAQNEFFRAFFRLPRKEKLHAVVDCSLWTPFSR
CHTAGRMFASDSYICFASREDGCCKIILPLREVVS
IEKME- Isotype
- IgG
- Antibody clone number
- 1A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TBC1D8 monoclonal antibody (M02), clone 1A12 Western Blot analysis of TBC1D8 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TBC1D8 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TBC1D8 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol