Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406414 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KPNA2 antibody: synthetic peptide directed towards the middle region of human KPNA2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW
TMSNI TAGRQDQIQQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Oxidative stress mislocalizes and retains transport factor importin-alpha and nucleoporins Nup153 and Nup88 in nuclei where they generate high molecular mass complexes.
Kodiha M, Tran D, Qian C, Morogan A, Presley JF, Brown CM, Stochaj U
Biochimica et biophysica acta 2008 Mar;1783(3):405-18
Biochimica et biophysica acta 2008 Mar;1783(3):405-18
No comments: Submit comment
No validations: Submit validation data