ABIN406414

KPNA1 antibody from antibodies-online
IPOA5, NPI-1, RCH2, SRP1

Antibody data

Product number
ABIN406414
Provider
antibodies-online
Product name
anti-Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2) (Middle Region) antibody
Provider product page
antibodies-online - ABIN406414
Antibody type
Polyclonal
Antigen
The immunogen for anti-KPNA2 antibody: synthetic peptide directed towards the middle region of human KPNA2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW
TMSNI TAGRQDQIQQ
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -