ABIN785702

KPNA1 antibody from antibodies-online
IPOA5, NPI-1, RCH2, SRP1

Antibody data

Product number
ABIN785702
Provider
antibodies-online
Product name
anti-Karyopherin alpha 1 (Importin alpha 5) (KPNA1) (N-Term) antibody
Provider product page
antibodies-online - ABIN785702
Antibody type
Polyclonal
Antigen
The immunogen for anti-KPNA1 antibody: synthetic peptide directed towards the N terminal of human KPNA1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Zebrafish
Host
Rabbit
Antigen sequence
NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRK
LLSKE PNPPIDEVIS
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -