HPA003647

DNAL4 antibody from Atlas Antibodies
dJ327J16, PIG27
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003647
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003647, RRID:AB_1078712
Product name
Anti-DNAL4
Provider product page
Atlas Antibodies - HPA003647
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVET
MELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH
VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -