HPA003647

DNAL4 antibody from Sigma-Aldrich
dJ327J16, PIG27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003647
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003647, RRID:AB_1078712
Product name
Anti-DNAL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003647
Antibody type
Polyclonal
Antigen
Dynein light chain 4, axonemal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVET
MELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH
VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Storage
-20C
Provider Type Product Number
- No reagents -