Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183393 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Annexin A5 (ANXA5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ANXA5 antibody: synthetic peptide directed towards the N terminal of human ANXA5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQ
VYEEE YGSSLEDDVV- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Neutrophils in Barth syndrome (BTHS) avidly bind annexin-V in the absence of apoptosis.
Kuijpers TW, Maianski NA, Tool AT, Becker K, Plecko B, Valianpour F, Wanders RJ, Pereira R, Van Hove J, Verhoeven AJ, Roos D, Baas F, Barth PG
Blood 2004 May 15;103(10):3915-23
Blood 2004 May 15;103(10):3915-23
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting