HPA028326

SPATA6 antibody from Sigma-Aldrich
FLJ10007, SRF-1, SRF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028326
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028326, RRID:AB_10610558
Product name
Anti-SPATA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028326
Antibody type
Polyclonal
Antigen
spermatogenesis associated 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSDWCSPSNCDEIHDRVKNVLKSHQAHQRHLYDER
DLEKDDELELKRSLLCRDSAYDSDPEYSSCQQPRG
TFHLDDGEYWSNRAASYKGKSHRPIFENSM
Storage
-20C
Provider Type Product Number
- No reagents -