Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
- Flow cytometry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA42 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- ESAM
- Antibody type
- Polyclonal
- Antigen
- Recombinant human ESAM
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
ISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLP
ANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFV
MWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPS
RNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHS
IKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQS
PRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSL
TNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPG
ARSHHHHHH- Antibody clone number
- Rabbit IG
- Vial size
- 200 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western Analysis of anti-human ESAM. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions.
- Sample type
- Purified recombinant protein
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Immunofluorescence staining of vascular endothelial cells from human foreskin (cryo-section of unfixed tissue) with anti-human ESAM (green/red). Specimen provided by Prof. Dr. J. Wilting and Dr. K. Buttler, Göttingen. The experiment was performed by the research group of Prof. Dr. J. Wilting, University Göttingen, Germany.
- Sample type
- Human Foreskin
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- FACS analysis with primary human dermal lymphatic endothelial cells (HDLEC).