Antibody data

Product number
H00090952-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00090952-M03, RRID:AB_1237696
Product name
ESAM monoclonal antibody (M03), clone 1G8
Provider product page
Abnova Corporation - H00090952-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ESAM.
Antigen sequence
MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHL
PANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPF
VMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMP
SRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGH
SIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQ
SPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLS
LTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGP
GAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEE
PANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTS
ARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTT
DGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQ
AGSLV
Isotype
IgG
Antibody clone number
1G8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -