Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501415 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNH2 antibody: synthetic peptide directed towards the middle region of human KCNH2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLG
ALTSQ PLHRHGSDPG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutation site dependent variability of cardiac events in Japanese LQT2 form of congenital long-QT syndrome.
Nagaoka I, Shimizu W, Itoh H, Yamamoto S, Sakaguchi T, Oka Y, Tsuji K, Ashihara T, Ito M, Yoshida H, Ohno S, Makiyama T, Miyamoto Y, Noda T, Kamakura S, Akao M, Horie M
Circulation journal : official journal of the Japanese Circulation Society 2008 May;72(5):694-9
Circulation journal : official journal of the Japanese Circulation Society 2008 May;72(5):694-9
No comments: Submit comment
No validations: Submit validation data