Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026994-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026994-A01, RRID:AB_463110
- Product name
- RNF11 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant RNF11.
- Antigen sequence
EEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIREC
VICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSF
TCPSCMEPVDAALLSSYETN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The ubiquitin-editing enzyme A20 requires RNF11 to downregulate NF-kappaB signalling.
The WW domain containing E3 ubiquitin protein ligase 1 upregulates ErbB2 and EGFR through RING finger protein 11.
Shembade N, Parvatiyar K, Harhaj NS, Harhaj EW
The EMBO journal 2009 Mar 4;28(5):513-22
The EMBO journal 2009 Mar 4;28(5):513-22
The WW domain containing E3 ubiquitin protein ligase 1 upregulates ErbB2 and EGFR through RING finger protein 11.
Chen C, Zhou Z, Liu R, Li Y, Azmi PB, Seth AK
Oncogene 2008 Nov 20;27(54):6845-55
Oncogene 2008 Nov 20;27(54):6845-55
No comments: Submit comment
No validations: Submit validation data