HPA028098

TTC39A antibody from Sigma-Aldrich
C1orf34, DEME-6, KIAA0452
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028098
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028098, RRID:AB_10601705
Product name
Anti-TTC39A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028098
Antibody type
Polyclonal
Antigen
tetratricopeptide repeat domain 39A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YFSSNPISLPVPALEMMYIWNGYAVIGKQPKLTDG
ILEIITKAEEMLEKGPENEYSVDDECLVKLLKGLC
LKYLG
Storage
-20C
Provider Type Product Number
- No reagents -