Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010954-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010954-M01, RRID:AB_509251
- Product name
- PDIA5 monoclonal antibody (M01), clone 3A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PDIA5.
- Antigen sequence
ERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLR
LLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVD
LSPKDKKVELFHYQDGAFHTEYNRAVTFKS- Isotype
- IgG
- Antibody clone number
- 3A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Unfolded protein response is not activated in the mucopolysaccharidoses but protein disulfide isomerase 5 is deregulated.
Villani GR, Chierchia A, Di Napoli D, Di Natale P
Journal of inherited metabolic disease 2012 May;35(3):479-93
Journal of inherited metabolic disease 2012 May;35(3):479-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PDIA5 monoclonal antibody (M01), clone 3A3 Western Blot analysis of PDIA5 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PDIA5 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PDIA5 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
