Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038490 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-FEZ1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
APLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHH
LEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNV
CFRN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references HIV-1 Exploits CLASP2 To Induce Microtubule Stabilization and Facilitate Virus Trafficking to the Nucleus
Fasciculation and elongation zeta‐1 protein (FEZ1) interacts with the retinoic acid receptor and participates in transcriptional regulation of the Hoxb4 gene
Localized Phosphorylation of a Kinesin-1 Adaptor by a Capsid-Associated Kinase Regulates HIV-1 Motility and Uncoating
HIV-1 capsids bind and exploit the kinesin-1 adaptor FEZ1 for inward movement to the nucleus
Mitra S, Shanmugapriya S, Santos da Silva E, Naghavi M, Kirchhoff F
Journal of Virology 2020;94(14)
Journal of Virology 2020;94(14)
Fasciculation and elongation zeta‐1 protein (FEZ1) interacts with the retinoic acid receptor and participates in transcriptional regulation of the Hoxb4 gene
Bertini Teixeira M, Figueira A, Furlan A, Aquino B, Alborghetti M, Paes Leme A, Wei L, Kobarg J
FEBS Open Bio 2017;8(1):4-14
FEBS Open Bio 2017;8(1):4-14
Localized Phosphorylation of a Kinesin-1 Adaptor by a Capsid-Associated Kinase Regulates HIV-1 Motility and Uncoating
Malikov V, Naghavi M
Cell Reports 2017;20(12):2792-2799
Cell Reports 2017;20(12):2792-2799
HIV-1 capsids bind and exploit the kinesin-1 adaptor FEZ1 for inward movement to the nucleus
Malikov V, da Silva E, Jovasevic V, Bennett G, de Souza Aranha Vieira D, Schulte B, Diaz-Griffero F, Walsh D, Naghavi M
Nature Communications 2015;6(1)
Nature Communications 2015;6(1)
No comments: Submit comment
No validations: Submit validation data