Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003703-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003703-M02, RRID:AB_530104
- Product name
- ITM1 monoclonal antibody (M02), clone 4D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ITM1.
- Antigen sequence
GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNC
LMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKD
FELDVLEEAYTTEHWLVRIYKVKDLDNRG- Isotype
- IgG
- Antibody clone number
- 4D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Oxidoreductase activity is necessary for N-glycosylation of cysteine-proximal acceptor sites in glycoproteins.
Keratinocyte-associated protein 2 is a bona fide subunit of the mammalian oligosaccharyltransferase.
Cherepanova NA, Shrimal S, Gilmore R
The Journal of cell biology 2014 Aug 18;206(4):525-39
The Journal of cell biology 2014 Aug 18;206(4):525-39
Keratinocyte-associated protein 2 is a bona fide subunit of the mammalian oligosaccharyltransferase.
Roboti P, High S
Journal of cell science 2012 Jan 1;125(Pt 1):220-32
Journal of cell science 2012 Jan 1;125(Pt 1):220-32
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ITM1 expression in transfected 293T cell line by ITM1 monoclonal antibody (M02), clone 4D4.Lane 1: ITM1 transfected lysate(80.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ITM1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol