HPA035279

CCDC14 antibody from MilliporeSigma / Merck KGaA
DKFZp434L1050, FLJ12892
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035279
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-CCDC14 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035279
Antibody type
Polyclonal
Antigen
coiled-coil domain containing 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IIYQALCEHVQTQMSLMNDLTSKNIPNGIPAVPCH
APSHSESQATPHSSYGLCTSTPVWSLQRPPCPPKV
HSEVQTDGNSQFASQG
Storage
-20C