Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054763-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054763-M03, RRID:AB_581763
- Product name
- ROPN1 monoclonal antibody (M03), clone 4E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ROPN1.
- Antigen sequence
MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALAC
SALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQ
FLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGL
ITVNDFTQNPRVWLE- Isotype
- IgG
- Antibody clone number
- 4E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Functional expression of ropporin in human testis and ejaculated spermatozoa.
Chen J, Wang Y, Wei B, Lai Y, Yan Q, Gui Y, Cai Z
Journal of andrology 2011 Jan-Feb;32(1):26-32
Journal of andrology 2011 Jan-Feb;32(1):26-32
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ROPN1 is approximately 10ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ROPN1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol