H00010767-B01P

HBS1L antibody from Abnova Corporation
DKFZp434g247, EF-1a, eRF3c, ERFS, HBS1, HSPC276, KIAA1038

Antibody data

Product number
H00010767-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010767-B01P, RRID:AB_1237836
Product name
HBS1L purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010767-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human HBS1L protein.
Antigen sequence
MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPS
TAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSN
HQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAV
LKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGK
IAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMG
FEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLE
TASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQI
DVKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHM
LYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDE
TGEERERGVTMDVGMTKFETTTKVITLMDAPGHKD
FIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQ
TREHGLLVRSLGVTQLAVAVNKMDQVNWQQERFQE
ITGKLGHFLKQAGFKESDVGFIPTSGLSGENLITR
SQSSELTKWYKGLCLLEQIDSFKPPQRSIDKPFRL
CVSDVFKDQGSGFCITGKIEAGYIQTGDRLLAMPP
NETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDII
KINVGCIFCGPKVPIKACTRFRARILIFNIEIPIT
KGFPVLLHYQTVSEPAVIKRLISVLNKSTGEVTKK
KPKFLTKGQNALVELQTQRPIALELYKDFKELGRF
MLRYGGSTIAAGVVTEIKE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -