PAB19995

ACOT4 antibody from Abnova Corporation
FLJ31235, PTE-Ib, PTE2B

Antibody data

Product number
PAB19995
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB19995, RRID:AB_10967671
Product name
ACOT4 polyclonal antibody
Provider product page
Abnova Corporation - PAB19995
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ACOT4.
Antigen sequence
PPLGYDLRRIKVAFSGLVDIVDIRNALVGGYKNPS
MIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERL
QAHGKEKPQIICYPGTGHYIEPPYFPLCPASLHRL
LNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGG
TQKT
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -