HPA000779

ACOT4 antibody from Atlas Antibodies
FLJ31235, PTE-Ib, PTE2B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000779
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000779, RRID:AB_1078093
Product name
Anti-ACOT4
Provider product page
Atlas Antibodies - HPA000779
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PPLGYDLRRIKVAFSGLVDIVDIRNALVGGYKNPS
MIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERL
QAHGKEKPQIICYPGTGHYIEPPYFPLCPASLHRL
LNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGG
TQKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -