HPA000779

ACOT4 antibody from MilliporeSigma / Merck KGaA
FLJ31235, PTE-Ib, PTE2B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000779
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA000779, RRID:AB_1078093
Product name
Anti-ACOT4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA000779
Antibody type
Polyclonal
Antigen
Acyl-CoA thioesterase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPLGYDLRRIKVAFSGLVDIVDIRNALVGGYKNPS
MIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERL
QAHGKEKPQIICYPGTGHYIEPPYFPLCPASLHRL
LNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGG
TQKT
Storage
-20C
Provider Type Product Number
- No reagents -