HPA004858

ZMAT5 antibody from Sigma-Aldrich
SNRNP20, ZC3H19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004858
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004858, RRID:AB_1080657
Product name
Anti-ZMAT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004858
Antibody type
Polyclonal
Antigen
Zinc finger matrin-type protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKR
PCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVE
EERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAP
S
Storage
-20C
Provider Type Product Number
- No reagents -