PAB22345

MTFR2 antibody from Abnova Corporation
DUFD1, FAM54A

Antibody data

Product number
PAB22345
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22345, RRID:AB_10986636
Product name
FAM54A polyclonal antibody
Provider product page
Abnova Corporation - PAB22345
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FAM54A.
Antigen sequence
LILNILREMLEYFGVPVEQVLLIWENKDYGSTRSI
VRIIGKMLPLEPCRRPNFELIPLLNSVDSDNCGSM
VPSFADILYVANDEEASYL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -