HPA029794

MTFR2 antibody from MilliporeSigma / Merck KGaA
DUFD1, FAM54A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029794
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029794, RRID:AB_10600535
Product name
Anti-FAM54A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029794
Antibody type
Polyclonal
Antigen
family with sequence similarity 54, member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LILNILREMLEYFGVPVEQVLLIWENKDYGSTRSI
VRIIGKMLPLEPCRRPNFELIPLLNSVDSDNCGSM
VPSFADILYVANDEEASYL
Storage
-20C
Provider Type Product Number
- No reagents -