Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504672 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-General Transcription Factor IIH, Polypeptide 1, 62kDa (GTF2H1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the middle region of human GTF2H1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTA
YNKLH TWQSRRLMKK- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Comprehensive analysis of DNA repair gene variants and risk of meningioma.
Bethke L, Murray A, Webb E, Schoemaker M, Muir K, McKinney P, Hepworth S, Dimitropoulou P, Lophatananon A, Feychting M, Lönn S, Ahlbom A, Malmer B, Henriksson R, Auvinen A, Kiuru A, Salminen T, Johansen C, Christensen HC, Kosteljanetz M, Swerdlow A, Houlston R
Journal of the National Cancer Institute 2008 Feb 20;100(4):270-6
Journal of the National Cancer Institute 2008 Feb 20;100(4):270-6
No comments: Submit comment
No validations: Submit validation data