Antibody data

Product number
ABIN404995
Provider
antibodies-online
Product name
anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404995
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNJ1 antibody: synthetic peptide directed towards the middle region of human KCNJ1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Canine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININ
FVVDA GNENLFFISP
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -